PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00032991-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 347aa    MW: 38737.8 Da    PI: 6.0506
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00032991-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.67e-14346146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      rg ++++E+ l+++++  lG++ W+ Ia +++ gRt++++k+ w++
  PSME_00032991-RA  3 RGTFSPQEESLIIELHGVLGNR-WSQIATHLP-GRTDNEIKNLWNS 46
                      899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.971152IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-20152IPR009057Homeodomain-like
SMARTSM007174.9E-12250IPR001005SANT/Myb domain
SuperFamilySSF466891.87E-13261IPR009057Homeodomain-like
PfamPF002491.2E-12346IPR001005SANT/Myb domain
CDDcd001679.34E-9545No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
LKRGTFSPQE ESLIIELHGV LGNRWSQIAT HLPGRTDNEI KNLWNSCIKK KLRQRGIDPN  60
THRPLSEVNA EAEDNKNGSS NKKVETQVAM EESHVSAGNE FKHLNADTPN PKFFHVSVED  120
NSLFASDSQA MLHNGLMDSN NSTTTTTSTA SAANISLPKE FFLERFNSVI ATPTSVEPGF  180
NFINQTSPAQ GFTAEKDHKL IDNPVLWLRA RSVGFPTENL MPWPGQVCDK SVSDAFSDFS  240
SDRPGPCLSS LLYSERSLDQ DLLDNADTNC MNGTAQYWDN TENNNNNMRT SSTSSSCNSS  300
TANLEVNNGA VFGHFWGFGE RLDVRSPPKM SERLRYFWRK QRPNTLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-1315257108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1081360.0BT108136.1 Picea glauca clone GQ03117_E18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYF21e-179A5JYF2_PICGL; R2R3-MYB transcription factor MYB8
STRINGPOPTR_0005s00340.12e-35(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-36myb domain protein 61